PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_008202-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family CO-like
Protein Properties Length: 365aa    MW: 40554.2 Da    PI: 5.2929
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_008202-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.31e-051857437
       zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                   r+C+ + +     fC+ ++ +lC+ C   +H        H
  NNU_008202-RA 18 RMCDSCRSAACAVFCRADSAYLCAGCDARIHAVnqvasrH 57
                   68******99*******************99334455555 PP

2zf-B_box27.56.3e-0960105342
       zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                     ++C+ +e+ ++ + C+ +   lC +C   +H+       H +vp+
  NNU_008202-RA  60 VWVCEACERAPAAFTCKADAAALCTTCDADIHSAnplarrHHRVPI 105
                    689*****************************66899999877775 PP

3CCT71.52.1e-24296339144
            CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                    Rea++lRY+eKrktRkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  NNU_008202-RA 296 REAKVLRYREKRKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT 339
                    9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.0E-91562IPR000315B-box-type zinc finger
PROSITE profilePS5011910.1531562IPR000315B-box-type zinc finger
CDDcd000211.40E-71862No hitNo description
PROSITE profilePS5011911.03558105IPR000315B-box-type zinc finger
PfamPF006436.9E-759105IPR000315B-box-type zinc finger
CDDcd000215.28E-861105No hitNo description
SMARTSM003361.7E-963105IPR000315B-box-type zinc finger
PROSITE profilePS5101716.767296338IPR010402CCT domain
PfamPF062033.5E-18296338IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MMLKEEGSSG GSRGGWARMC DSCRSAACAV FCRADSAYLC AGCDARIHAV NQVASRHERV  60
WVCEACERAP AAFTCKADAA ALCTTCDADI HSANPLARRH HRVPILPIAG CLYGPSPTNP  120
GRRVRPDINI EDGFMTQEGD EDIDEEDEDE TASWLLLNPG KNDNNQNNNG FLLGGEVDEY  180
LDLVDYSSCT DNQYNQQQHY SVQHKNDGSD SVVPVQCLAV KEEQQQQNLH LDMDYDASKP  240
GFSYSHSVSL SSMDASVVPD AMMNDISNSH SRPPKGTIDL FSSPLAMPPQ FTPMDREAKV  300
LRYREKRKTR KFEKTIRYAS RKAYAETRPR IKGRFAKRTD VEVEVEQMFS TTVLAESGYG  360
VVPSF
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5151507e-32AY515150.1 Populus deltoides CONSTANS-like protein CO1 mRNA, complete cds.
GenBankEF1477177e-32EF147717.1 Populus trichocarpa clone WS0124_I04 unknown mRNA.
GenBankHQ8333667e-32HQ833366.1 Populus tremula col2a (col2a) gene, exon 2 and partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010257847.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 2
SwissprotQ965021e-133COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLA0A0D3R2G60.0A0A0D3R2G6_G
STRINGPOPTR_0017s14410.11e-169(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.14e-91CONSTANS-like 2